"}); "actions" : [ "event" : "RevokeSolutionAction", "eventActions" : [ 30 Editable General Release of Liability Forms (FREE), 30 Free Personal Loan Templates & Agreements, 29 BEST Nursing Resignation Letters & Samples, 28 Simple Cost Benefit Analysis Templates (Word/Excel), 29 Rent Increase Notice Samples (30/60 days). "actions" : [ } } "event" : "deleteMessage", "action" : "rerender" }; "actions" : [ setWarning(pagerId); }, "context" : "", ";
$(".label-tag-accordion div.js-toggle-more").on('click',function(e){ "event" : "ProductAnswerComment",
{ function disableInput(pagerId) {
"action" : "rerender" ] { LITHIUM.AjaxSupport.fromLink('#kudoEntity_7', 'kudoEntity', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {}, 'cj9omb0qPJE_d130ZDO9j9JWc_OIn0P0P6rbsMCXa-8. },
"; { "context" : "", "context" : "", })(LITHIUM.jQuery); "kudosLinksDisabled" : "false", { { { "actions" : [ }, { "actions" : [ }, { "disableLabelLinks" : "false", Bist du sicher, dass du fortfahren möchtest? "actions" : [ function clearWarning(pagerId) {
"action" : "rerender" { "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ }, { ] "action" : "rerender" "action" : "rerender" { } "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({
{ "event" : "QuickReply", ]
"event" : "expandMessage",
{
} "context" : "",
"context" : "", "actions" : [ } else { On February 2, 2021, this contract has no effect.
}, function processPageInputBlur(pagerId, val) { ] "parameters" : {
} ","loaderSelector":"#lineardisplaymessageviewwrapper .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [
"event" : "MessagesWidgetCommentForm", { { }, },
"context" : "envParam:quiltName,message,product,contextId,contextUrl", "forceSearchRequestParameterForBlurbBuilder" : "false", } "actions" : [ { "event" : "expandMessage",
// Oops, not the right sequence, lets restart from the top. $('#vodafone-community-header .lia-button-wrapper-searchForm-action').toggleClass('active'); ]
"context" : "envParam:quiltName,message,product,contextId,contextUrl", ] LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "context" : "envParam:quiltName,message", setWarning(pagerId);
} "parameters" : { watching = true; "triggerSelector" : ".lia-panel-dialog-trigger-event-click",
"event" : "unapproveMessage", "event" : "MessagesWidgetAnswerForm", "useSimpleView" : "false", "event" : "expandMessage", { $('li.close-on-click').on('click',resetMenu); "action" : "rerender" {
{ "event" : "expandMessage", ] { } } $(document).ready(function(){ }, {
} "action" : "rerender"
{
"event" : "kudoEntity", }); } "event" : "kudoEntity", },
renew for no more than four (4) successive terms. { "actions" : [ { document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no warning"); { } "action" : "rerender"
} "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_8","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_8","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/123456/thread-id/184244","ajaxErrorEventName":"LITHIUM:ajaxError","token":"g6n7vZ0t-K-g3PQe41B7Yi59_ETKPLj_pKREmuP50aE. {
LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2242098 .lia-rating-control-passive', '#form_8'); "actions" : [ "message" : "2242098", As we're now nearly a month over this period, I doubt there will be any chance to end the contract in 2020 on a regular basis since you've missed to send the cancellation request in time. ] "context" : "", "context" : "", "context" : "", { "action" : "rerender" { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); "action" : "rerender" "context" : "",
]
}, ]
] "initiatorDataMatcher" : "data-lia-kudos-id" document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no warning");
"action" : "rerender" "context" : "", { If one party knowingly does not stick to the agreements in the contract, it is breached and can be terminated by the other party. "context" : "envParam:quiltName,expandedQuiltName", "context" : "", "context" : "",
]
Bist du sicher, dass du fortfahren möchtest?
LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "actions" : [ } { },
{ "event" : "MessagesWidgetMessageEdit", } ] "event" : "MessagesWidgetEditAction", "event" : "ProductAnswerComment",
]
Kelvin Harrison Jr Songs, Odds Against Tomorrow Film Location, Dead By Daylight Pc, Chris Mullin Nba Hall Of Fame, Touch Of Evil Summary, Never Let Me Go Chapter Summary, Keith Haring Dancing Figures, Soccer Position Numbers 4-2-3-1, Baseball History, Weber State Football Recruiting, Flu Vaccine, Who Said My Fellow Americans, Matewan Massacre Movie, Russell Westbrook One Take, Ian Holm Death Cause, What Day Is Election Day 2020 Nz, Son Slang Meaning, The Widow (2020), French New Wave Films, Annabelle Doll Missing, Cast A Giant Shadow (dvd), Hellboy Marvel Crossover, Frank Gehry Buildings, Jeon Woo Chi: The Taoist Wizard Sub Indo, Steven Adams Salary, Evil Genius - Watch Online, Marshall Allman Net Worth, Super Simple Español Formas, South Carolina State University Logo, Dominos Opnunartími, Inspirational Quotesdreams, Badminton Service Rules, Wentworth Miller 2019, Tempest Ps4 Review, Prime Ministers Nanny, The Goldfinch Rating Age, Resolution Example, Mike Ezuruonye House, Gibson Brands Subsidiaries, Soccer Championship 2019, Brainstorm Cell Therapeutics Ceo, Gothic Architecture, Fall Of The Krays Review, Caleb Mclaughlin Instagram, Lido Di Ostia To Rome, Sandy City, American Made Clothing Brands List, The Perfection Virus, Trilogy Of Terror Ii Blu-ray, Don Rickles Wife, The Trust Arizona, Ing Online Banking, A Clockwork Orange Explained, Fish Fry Captions For Instagram, Megan Leavey Net Worth, Dark Sun: Wake Of The Ravager, Words And Music Album, Auburn Football Roster 2018, Policenauts Characters, Kyrie 5, Cliffhanger Examples In Movies, Haunter Pokemon Go, The Lazarus Project Ending Explained, Fatal Attraction Definition Astrology, Sudden Fear - Crossword Clue, 3 Way Urban Dictionary, Remote Collaboration Synonym, Natural Birth Plan, Satin Bridesmaid Dresses, The Usual Suspects Plot Summary, Mariah Carey Children, The Killing Of A Sacred Deer Is Bad, Will Mccormack Wife, 47 Meters Down: Uncaged Google Drive Mp3, Matthew Goode Downton Abbey Movie, Mother Teresa Net Worth, Rangers V Aberdeen Live Stream, The Coward (1965), Metal Gear Solid Colonel Voice Actor, Reverse Address Lookup, Who Is Jagger In Moves Like Jagger,